PDB entry 3e11

View 3e11 on RCSB PDB site
Description: Crystal structure of predicted zincin-like metalloprotease (YP_873820.1) from ACIDOTHERMUS CELLULOLYTICUS 11B at 1.80 A resolution
Class: structural genomics, unknown function
Keywords: YP_873820.1, predicted zincin-like metalloprotease, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, Domain of unknown function (DUF1025), unknown function
Deposited on 2008-08-01, released 2008-08-19
The last revision prior to the SCOP 1.75 freeze date was dated 2008-08-19, with a file datestamp of 2008-08-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: predicted zincin-like metalloprotease
    Species: Acidothermus cellulolyticus 11B, synthetic [TaxId:351607]
    Gene: YP_873820.1, Acel_2062
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0LWM4 (1-113)
      • leader sequence (0)
    Domains in SCOP 1.75: d3e11a1
  • Chain 'B':
    Compound: predicted zincin-like metalloprotease
    Species: Acidothermus cellulolyticus 11B, synthetic [TaxId:351607]
    Gene: YP_873820.1, Acel_2062
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0LWM4 (1-113)
      • leader sequence (0)
    Domains in SCOP 1.75: d3e11b1
  • Heterogens: ACT, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e11A (A:)
    gmvyvdpdrfdelvaealdgipeefaramrnvavfvedepddpellglyvgipltertta
    yggvlpdriiiyrnticalcetesevidevrktvvheiahhfgidderlhelgy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3e11B (B:)
    gmvyvdpdrfdelvaealdgipeefaramrnvavfvedepddpellglyvgipltertta
    yggvlpdriiiyrnticalcetesevidevrktvvheiahhfgidderlhelgy