PDB entry 3e0q

View 3e0q on RCSB PDB site
Description: Crystal structure of Schistosoma mansoni purine nucleoside phosphorylase complexed with a novel monocyclic inhibitor
Class: transferase
Keywords: Monocyclic inhibitor, Glycosyltransferase, Transferase
Deposited on 2008-07-31, released 2009-08-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SmPNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e0qa_
  • Chain 'B':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SmPNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e0qb_
  • Chain 'C':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SmPNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3e0qc_
  • Heterogens: DMS, JFD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e0qA (A:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e0qA (A:)
    vtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqtshs
    gnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaagglnrslk
    lgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaeengfgn
    lvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavslvtnis
    vldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e0qB (B:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e0qB (B:)
    svtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqtsh
    sgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaagglnrsl
    klgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaeengfg
    nlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavslvtni
    svldveqraelmqswfekiieklpkd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e0qC (C:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e0qC (C:)
    esvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqts
    vvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaaggl
    nrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaee
    ngfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavsl
    vtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd