PDB entry 3dz8

View 3dz8 on RCSB PDB site
Description: Crystal structure of human Rab3B GTPase bound with GDP
Class: protein transport
Keywords: ras, gdp, gtpase, structural genomics consortium, sgc, Cell membrane, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Phosphoprotein, Prenylation, Protein transport, Transport
Deposited on 2008-07-29, released 2008-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-3B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB3B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20337 (18-End)
      • expression tag (10-17)
    Domains in SCOPe 2.06: d3dz8a1, d3dz8a2
  • Heterogens: GDP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dz8A (A:)
    mhhhhhhssgrenlyfqgnfdymfklliignssvgktsflfryaddtftpafvstvgidf
    kvktvyrhekrvklqiwdtagqeryrtittayyrgamgfilmyditneesfnavqdwatq
    iktyswdnaqvilvgnkcdmeeervvptekgqllaeqlgfdffeasakenisvrqaferl
    vdaicdkmsds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dz8A (A:)
    renlyfqgnfdymfklliignssvgktsflfryaddtftpafvstvgidfkvktvyrhek
    rvklqiwdtagqeryrtittayyrgamgfilmyditneesfnavqdwatqiktyswdnaq
    vilvgnkcdmeeervvptekgqllaeqlgfdffeasakenisvrqaferlvdaicdkm