PDB entry 3dyr

View 3dyr on RCSB PDB site
Description: Crystal structure of E. coli thioredoxin mutant I76T in its oxidized form
Class: electron transport
Keywords: mutant protein, Electron transport, Host-virus interaction, Redox-active center, Transport
Deposited on 2008-07-28, released 2009-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin-1
    Species: Escherichia coli [TaxId:83333]
    Gene: trxA, fipA, tsnC, b3781, JW5856
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (1-108)
      • expression tag (0)
      • engineered (75)
      • expression tag (109-110)
    Domains in SCOPe 2.07: d3dyra1, d3dyra2, d3dyra3
  • Chain 'B':
    Compound: Thioredoxin-1
    Species: Escherichia coli [TaxId:83333]
    Gene: trxA, fipA, tsnC, b3781, JW5856
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (Start-108)
      • engineered (75)
    Domains in SCOPe 2.07: d3dyrb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dyrA (A:)
    gsdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvakln
    idqnpgtapkygirgtptlllfkngevaatkvgalskgqlkefldanlaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dyrB (B:)
    gsdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvakln
    idqnpgtapkygirgtptlllfkngevaatkvgalskgqlkefldanlaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dyrB (B:)
    dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgtptlllfkngevaatkvgalskgqlkefldanla