PDB entry 3dyp

View 3dyp on RCSB PDB site
Description: E. coli (lacZ) beta-galactosidase (H418N)
Class: hydrolase
Keywords: beta-galactosidase, Glycosidase, Hydrolase
Deposited on 2008-07-28, released 2008-10-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.159
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactosidase
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: lacZ, b0344, JW0335
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • engineered (417)
    Domains in SCOPe 2.04: d3dypa1, d3dypa2, d3dypa3, d3dypa4, d3dypa5
  • Chain 'B':
    Compound: beta-galactosidase
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: lacZ, b0344, JW0335
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • engineered (417)
    Domains in SCOPe 2.04: d3dypb1, d3dypb2, d3dypb3, d3dypb4, d3dypb5
  • Chain 'C':
    Compound: beta-galactosidase
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: lacZ, b0344, JW0335
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • engineered (417)
    Domains in SCOPe 2.04: d3dypc1, d3dypc2, d3dypc3, d3dypc4, d3dypc5
  • Chain 'D':
    Compound: beta-galactosidase
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: lacZ, b0344, JW0335
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00722 (Start-1022)
      • engineered (417)
    Domains in SCOPe 2.04: d3dypd1, d3dypd2, d3dypd3, d3dypd4, d3dypd5
  • Heterogens: MG, NA, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dypA (A:)
    gshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeanietngm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dypA (A:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeanietngmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dypB (B:)
    gshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeanietngm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dypB (B:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeanietngmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dypC (C:)
    gshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeanietngm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dypC (C:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeanietngmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dypD (D:)
    gshmledpvvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrf
    awfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenpt
    gcysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrag
    enrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravl
    eaevqmcgelrdylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpkl
    wsaeipnlyravvelhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehh
    plhgqvmdeqtmvqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeanietngm
    vpmnrltddprwlpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdp
    srpvqyegggadttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyah
    amgnslggfakywqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrq
    fcmnglvfadrtphpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldg
    kplasgevpldvapqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqw
    rlaenlsvtlpaashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltpl
    rdqftrapldndigvseatridpnawverwkaaghyqaeaallqctadtladavlittah
    awqhqgktlfisrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlgl
    gpqenypdrltaacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnis
    rysqqqlmetshrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvw
    cqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dypD (D:)
    rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
    wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
    wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
    dgsyledqdmwrmsgifrdvsllhkpttqisdfhvatrfnddfsravleaevqmcgelrd
    ylrvtvslwqgetqvasgtapfggeiiderggyadrvtlrlnvenpklwsaeipnlyrav
    velhtadgtlieaeacdvgfrevriengllllngkpllirgvnrhehhplhgqvmdeqtm
    vqdillmkqnnfnavrcshypnhplwytlcdryglyvvdeanietngmvpmnrltddprw
    lpamservtrmvqrdrnhpsviiwslgnesghganhdalyrwiksvdpsrpvqyegggad
    ttatdiicpmyarvdedqpfpavpkwsikkwlslpgetrplilceyahamgnslggfaky
    wqafrqyprlqggfvwdwvdqslikydengnpwsayggdfgdtpndrqfcmnglvfadrt
    phpalteakhqqqffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldv
    apqgkqlielpelpqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtlpa
    ashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapldnd
    igvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlfis
    rktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrlta
    acfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmetsh
    rhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk