PDB entry 3dxu

View 3dxu on RCSB PDB site
Description: The crystal structure of core JMJD2D complexed with FE and N-oxalylglycine
Class: oxidoreductase
Keywords: JMJD2D, JMJC, NOG, Histone demethylase, chromatin regulator, dioxygenase, iron, metal-binding, nucleus, oxidoreductase, transcription, transcription regulation
Deposited on 2008-07-25, released 2009-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: JmjC domain-containing histone demethylation protein 3D
    Species: Homo sapiens [TaxId:9606]
    Gene: JMJD2D, JHDM3D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dxua_
  • Heterogens: ZN, FE2, SO4, OGA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dxuA (A:)
    gstaqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydnis
    eiliatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywk
    nriynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkt
    tfawhtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkva
    lisptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkma
    sqcscgearvtfsmdafvrilqperydlwkrgqdgst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dxuA (A:)
    aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil
    iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri
    ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa
    whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis
    ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc
    scgearvtfsmdafvrilqperydlwkrgqd