PDB entry 3dwb

View 3dwb on RCSB PDB site
Description: structure of human ECE-1 complexed with phosphoramidon
Class: hydrolase
Keywords: protein, Disease mutation, Glycoprotein, Hirschsprung disease, Hydrolase, Membrane, Metal-binding, Metalloprotease, Phosphoprotein, Protease, Signal-anchor, Transmembrane, MCH_ECE_H_25A1_LT1.PDB
Deposited on 2008-07-22, released 2008-11-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.266
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endothelin-converting enzyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ECE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3dwba_
  • Heterogens: ZN, 5HD, RDF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dwbA (A:)
    seacvsvtssilssmdptvdpchdffsyacggwikanpvpdghsrwgtfsnlwehnqaii
    khllenstasvseaerkaqvyyracmnetrieelrakplmelierlggwnitgpwakdnf
    qdtlqvvtahyrtspffsvyvsadsknsnsnviqvdqsglglpsrdyylnktenekvltg
    ylnymvqlgkllgggdeeairpqmqqildfetalanitipqekrrdeeliyhkvtaaelq
    tlapainwlpflntifypveinesepivvydkeyleqistlinttdrcllnnymiwnlvr
    ktssfldqrfqdadekfmevmygtkktslprwkfcvsdtennlgfalgpmfvkatfaeds
    ksiateiileikkafeeslstlkwmdeetrksakekadaiynmigypnfimdpkeldkvf
    ndytavpdlyfenamrffnfswrvtadqlrkapnrdqwsmtppmvnayysptkneivfpa
    gilqapfytrsspkalnfggigvvvghelthafddqgreydkdgnlrpwwknssveafkr
    qtecmveqysnysvngepvngrhtlgeniadngglkaayrayqnwvkkngaehslptlgl
    tnnqlfflgfaqvwcsvrtpessheglitdphspsrfrvigslsnskefsehfrcppgsp
    mnpphkcevw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dwbA (A:)
    seacvsvtssilssmdptvdpchdffsyacggwikanpvpdghsrwgtfsnlwehnqaii
    khllenstasvseaerkaqvyyracmnetrieelrakplmelierlggwnitgpwakdnf
    qdtlqvvtahyrtspffsvyvsadsknsnsnviqvdqsglglpsrdyylnktenekvltg
    ylnymvqlgkllgggdeeairpqmqqildfetalanitipqekrrdeeliyhkvtaaelq
    tlapainwlpflntifypveinesepivvydkeyleqistlinttdrcllnnymiwnlvr
    ktssfldqrfqdadekfmevmwkfcvsdtennlgfalgpmfvkatfaedsksiateiile
    ikkafeeslstlkwmdeetrksakekadaiynmigypnfimdpkeldkvfndytavpdly
    fenamrffnfswrvtadqlrkapnrdqwsmtppmvnayysptkneivfpagilqapfytr
    sspkalnfggigvvvghelthafddqgreydkdgnlrpwwknssveafkrqtecmveqys
    nysvngepvngrhtlgeniadngglkaayrayqnwvkkngaehslptlgltnnqlfflgf
    aqvwcsvrtpessheglitdphspsrfrvigslsnskefsehfrcppgspmnpphkcevw