PDB entry 3duu

View 3duu on RCSB PDB site
Description: Crystal structure of SAG506-01, orthorhombic, twinned, crystal 2
Class: immune system
Keywords: antibody, KDO, twinning, pseudo-symmetry, IMMUNE SYSTEM
Deposited on 2008-07-17, released 2008-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-02, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.195
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody Fv fragment SAG506-01
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DUU (0-111)
    Domains in SCOPe 2.07: d3duua_
  • Chain 'B':
    Compound: Ig-like protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DUU (0-120)
    Domains in SCOPe 2.07: d3duub_
  • Chain 'C':
    Compound: antibody Fv fragment SAG506-01
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DUU (0-111)
    Domains in SCOPe 2.07: d3duuc_
  • Chain 'D':
    Compound: Ig-like protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DUU (0-120)
    Domains in SCOPe 2.07: d3duud_
  • Heterogens: KDO, MG, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3duuA (A:)
    divltqspsslavsagervtmsckssqslfksrnqknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltingvqaedlavyyckqsynlrtfgggtklelk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3duuB (B:)
    evklvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkakgytv
    eysasvkgrftisrdnsqsilylqmntlraedsatyycardgyyvdamdywgqgtsvtvs
    s
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3duuC (C:)
    divltqspsslavsagervtmsckssqslfksrnqknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltingvqaedlavyyckqsynlrtfgggtklelk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3duuD (D:)
    evklvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkakgytv
    eysasvkgrftisrdnsqsilylqmntlraedsatyycardgyyvdamdywgqgtsvtvs
    s