PDB entry 3dur

View 3dur on RCSB PDB site
Description: Crystal structure of SAG173-04
Class: immune system
Keywords: antibody, KDO, twinning, pseudo-symmetry, IMMUNE SYSTEM
Deposited on 2008-07-17, released 2008-12-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2008-12-02, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.182
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody Fv fragment SAG173-04
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DUR (0-111)
    Domains in SCOPe 2.04: d3dura_
  • Chain 'B':
    Compound: Ig-like protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DUR (0-120)
    Domains in SCOPe 2.04: d3durb_
  • Chain 'C':
    Compound: antibody Fv fragment SAG173-04
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DUR (0-111)
    Domains in SCOPe 2.04: d3durc_
  • Chain 'D':
    Compound: Ig-like protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DUR (0-120)
    Domains in SCOPe 2.04: d3durd_
  • Heterogens: KDO, MG, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3durA (A:)
    divmtqspsslavsagekvtmsckssqslfksrnqknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltingvqaedlavyyckqsynlrtfgggtklelk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3durB (B:)
    evqlvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkakgytt
    eysasvkgrfsisrdnsqsilylqmntlraedsatyycardgyyadamdywgqgtsvtvs
    s
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3durC (C:)
    divmtqspsslavsagekvtmsckssqslfksrnqknylawyqqkpgqspklliywastr
    esgvpdrftgsgsgtdftltingvqaedlavyyckqsynlrtfgggtklelk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3durD (D:)
    evqlvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkakgytt
    eysasvkgrfsisrdnsqsilylqmntlraedsatyycardgyyadamdywgqgtsvtvs
    s