PDB entry 3duh

View 3duh on RCSB PDB site
Description: Structure of Interleukin-23
Class: immune system/cytokine
Keywords: four-helix bundle cytokine, Ig domain, Cytokine, Glycoprotein, Immunoglobulin domain, Secreted, Antiviral defense, Immune response, Inflammatory response, Innate immunity, Tissue remodeling, IMMUNE SYSTEM, IMMUNE SYSTEM-CYTOKINE COMPLEX
Deposited on 2008-07-17, released 2008-08-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-12 subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: IL12B, NKSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29460 (2-307)
      • expression tag (1)
    Domains in SCOPe 2.06: d3duha1, d3duha2, d3duha3, d3duha4
  • Chain 'B':
    Compound: Interleukin-12 subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: IL12B, NKSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29460 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d3duhb1, d3duhb2, d3duhb3, d3duhb4
  • Chain 'C':
    Compound: Interleukin-23 subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: IL23A, SGRF, UNQ2498/PRO5798
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPF7 (1-End)
      • expression tag (0)
  • Chain 'D':
    Compound: Interleukin-23 subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: IL23A, SGRF, UNQ2498/PRO5798
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPF7 (1-170)
      • expression tag (0)
      • expression tag (171-173)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3duhA (A:)
    leiwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvk
    efgdagqytchkggevlshsllllhkkedgiwstdilkdqkepknktflrceaknysgrf
    tcwwlttistdltfsvkssrgssdpqgvtcgaatlsaervrgdnkeyeysvecqedsacp
    aaeeslpievmvdavhklkyenytssffirdiikpdppknlqlkplknsrqvevsweypd
    twstphsyfsltfcvqvqgkskrekkdrvftdktsatvicrknasisvraqdryysssws
    ewasvpcshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3duhA (A:)
    eiwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvke
    fgdagqytchkggevlshsllllhkkedgiwstdilkdqkepknktflrceaknysgrft
    cwwlttistdltfsvkssrgssdpqgvtcgaatlsaeeyeysvecqedsacpaaeeslpi
    evmvdavhklkyenytssffirdiikpdppknlqlkplknsrqvevsweypdtwstphsy
    fsltfcvqvqgkskrekkdrvftdktsatvicrknasisvraqdryyssswsewasvpcs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3duhB (B:)
    leiwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvk
    efgdagqytchkggevlshsllllhkkedgiwstdilkdqkepknktflrceaknysgrf
    tcwwlttistdltfsvkssrgssdpqgvtcgaatlsaervrgdnkeyeysvecqedsacp
    aaeeslpievmvdavhklkyenytssffirdiikpdppknlqlkplknsrqvevsweypd
    twstphsyfsltfcvqvqgkskrekkdrvftdktsatvicrknasisvraqdryysssws
    ewasvpcshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3duhB (B:)
    leiwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvk
    efgdagqytchkggevlshsllllhkkedgiwstdilkdqkepknktflrceaknysgrf
    tcwwlttistdltfsvkssrgssdpqgvtcgaatlsaenkeyeysvecqedsacpaaees
    lpievmvdavhklkyenytssffirdiikpdppknlqlkplqvevsweypdtwstphsyf
    sltfcvqvqgkkkdrvftdktsatvicrknasisvraqdryyssswsewasvpc
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.