PDB entry 3du8

View 3du8 on RCSB PDB site
Description: Crystal structure of GSK-3 beta in complex with NMS-869553A
Class: transferase
Keywords: Protein kinase, Alternative splicing, ATP-binding, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2008-07-17, released 2009-03-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-03-03, with a file datestamp of 2009-02-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.215
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3du8a_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3du8b_
  • Heterogens: 553, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3du8A (A:)
    gpmsgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytd
    tkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffys
    sgekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgic
    hrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssi
    dvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqika
    hpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpa
    lfnfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasasn
    st
    

    Sequence, based on observed residues (ATOM records): (download)
    >3du8A (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssvylnlvldyvpetvyrvarhysrakqtlpviyvkl
    ymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsr
    yyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreq
    iremnpfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdp
    nvklpngrdtpalfnfttqelssnpplatilippha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3du8B (B:)
    gpmsgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsytd
    tkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryffys
    sgekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfgic
    hrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdytssi
    dvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqika
    hpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdtpa
    lfnfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasasn
    st
    

    Sequence, based on observed residues (ATOM records): (download)
    >3du8B (B:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssvylnlvldyvpetvyrvarhysrakqtlpviyvkl
    ymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsr
    yyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreq
    iremnpfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdp
    nvklpngrdtpalfnfttqelssnpplatilipphariq