PDB entry 3dtu

View 3dtu on RCSB PDB site
Description: Catalytic core subunits (I and II) of cytochrome c oxidase from Rhodobacter sphaeroides complexed with deoxycholic acid
Class: oxidoreductase
Keywords: TRANSMEMBRANE PROTEIN COMPLEX, deoxycholic acid, Copper, Electron transport, Heme, Hydrogen ion transport, Ion transport, Iron, Membrane, Metal-binding, Oxidoreductase, Respiratory chain, Transmembrane, Transport
Deposited on 2008-07-15, released 2008-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: ctaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dtua_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: ctaC, coxII, ctaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03736 (Start-255)
      • expression tag (256-261)
    Domains in SCOPe 2.07: d3dtub1, d3dtub2, d3dtub3
  • Chain 'C':
    Compound: Cytochrome c oxidase subunit 1
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: ctaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dtuc_
  • Chain 'D':
    Compound: Cytochrome c oxidase subunit 2
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: ctaC, coxII, ctaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03736 (Start-255)
      • expression tag (256-259)
    Domains in SCOPe 2.07: d3dtud1, d3dtud2, d3dtud3
  • Heterogens: DMU, CU, MG, CA, OH, PO4, HEA, TRD, CD, HTO, DXC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dtuA (A:)
    madaaihghehdrrgfftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgv
    qfmcaehlesglvkgffqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfg
    nyfmplhigapdmafprmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplst
    sesgystdlaifavhlsgassilgainmittflnmrapgmtmhkvplfawsifvtawlil
    lalpvlagaitmlltdrnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivsh
    viatfakkpifgylpmvyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptg
    ikifswiatmwggsielktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahf
    hyvmslgavfgifagiyfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmp
    rryidypeafatwnfvsslgaflsfasflfflgvifytltrgarvtannywnehadtlew
    tltspppehtfeqlpkredwerapah
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dtuA (A:)
    rrgfftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesgl
    vkgffqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapd
    mafprmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaif
    avhlsgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitm
    lltdrnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifg
    ylpmvyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwg
    gsielktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgi
    fagiyfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafat
    wnfvsslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dtuB (B:)
    qqqsleiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhe
    krnkvparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwyw
    gyeypdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnkt
    vvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympi
    tvkvvseeayaawleqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dtuB (B:)
    sleiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrn
    kvparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwywgye
    ypdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnktvvv
    qvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympitvk
    vvseeayaawleqhhhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dtuC (C:)
    madaaihghehdrrgfftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgv
    qfmcaehlesglvkgffqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfg
    nyfmplhigapdmafprmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplst
    sesgystdlaifavhlsgassilgainmittflnmrapgmtmhkvplfawsifvtawlil
    lalpvlagaitmlltdrnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivsh
    viatfakkpifgylpmvyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptg
    ikifswiatmwggsielktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahf
    hyvmslgavfgifagiyfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmp
    rryidypeafatwnfvsslgaflsfasflfflgvifytltrgarvtannywnehadtlew
    tltspppehtfeqlpkredwerapah
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dtuC (C:)
    ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf
    fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafp
    rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl
    sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd
    rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm
    vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsie
    lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi
    yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv
    sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtfe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dtuD (D:)
    qqqsleiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhe
    krnkvparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwyw
    gyeypdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnkt
    vvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympi
    tvkvvseeayaawleqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dtuD (D:)
    qsleiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekr
    nkvparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwywgy
    eypdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnktvv
    vqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympitv
    kvvseeayaawleqhhhh