PDB entry 3dtr

View 3dtr on RCSB PDB site
Description: E(L212)Q, L(L227)F double mutant structure of photosynthetic reaction center from Rhodobacter sphaeroides
Class: photosynthesis
Keywords: Mutant photosynthetic reaction center, Phenotypic revertant, Proton transfer, membrane protein, PHOTOSYNTHESIS
Deposited on 2008-07-15, released 2009-06-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.195
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: reaction center protein h chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: puhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dtrh1, d3dtrh2
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: pufL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0Y8 (0-280)
      • engineered (211)
      • engineered (226)
    Domains in SCOPe 2.06: d3dtrl_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: pufM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dtrm_
  • Heterogens: BCL, BPH, U10, LDA, FE, SPN, CDL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3dtrH (H:)
    mvgvtafgnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpk
    pktfilphgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdl
    peldghghnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarfle
    velkdgstrllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagg
    lmyaapkrksvvaamlaeya
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dtrH (H:)
    dlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgr
    gtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnk
    ikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrl
    lpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkrks
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dtrL (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhqdtffrdlvgysigtfgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3dtrM (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hgmaplnhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dtrM (M:)
    nifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfsgl
    mwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffmfv
    avwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifshld
    wtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrgta
    aeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnhg