PDB entry 3dtg

View 3dtg on RCSB PDB site
Description: Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design
Class: transferase
Keywords: open twisted alpha/beta, Aminotransferase, Transferase
Deposited on 2008-07-15, released 2009-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.238
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched-chain amino acid aminotransferase
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene: ilvE, MSMEG_4276
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dtga_
  • Chain 'B':
    Compound: branched-chain amino acid aminotransferase
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene: ilvE, MSMEG_4276
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dtgb_
  • Heterogens: PLP, OBZ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dtgA (A:)
    ahhhhnsgpleftvsantnpatdavresilanpgfgkyytdhmvsidytvdegwhnaqvi
    pygpiqldpsaivlhygqeifeglkayrwadgsivsfrpeanaarlqssarrlaipelpe
    evfieslrqliavdekwvppaggeeslylrpfviatepglgvrpsneyrylliaspagay
    fkggikpvsvwlsheyvraspggtgaakfggnyaasllaqaqaaemgcdqvvwldaierr
    yveemggmnlffvfgsggsarlvtpelsgsllpgitrdsllqlatdagfaveerkidvde
    wqkkagageitevfacgtaavitpvshvkhhdgeftiadgqpgeitmalrdtltgiqrgt
    fadthgwmarln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dtgA (A:)
    leftvsantnpatdavresilanpgfgkyytdhmvsidytvdegwhnaqvipygpiqldp
    saivlhygqeifeglkayrwadgsivsfrpeanaarlqssarrlaipelpeevfieslrq
    liavdekwvppaggeeslylrpfviatepglgvrpsneyrylliaspagayfkggikpvs
    vwlsheyvraspggtgaakfggnyaasllaqaqaaemgcdqvvwldaierryveemggmn
    lffvfgsggsarlvtpelsgsllpgitrdsllqlatdagfaveerkidvdewqkkagage
    itevfacgtaavitpvshvkhhdgeftiadgqpgeitmalrdtltgiqrgtfadthgwma
    rln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dtgB (B:)
    ahhhhnsgpleftvsantnpatdavresilanpgfgkyytdhmvsidytvdegwhnaqvi
    pygpiqldpsaivlhygqeifeglkayrwadgsivsfrpeanaarlqssarrlaipelpe
    evfieslrqliavdekwvppaggeeslylrpfviatepglgvrpsneyrylliaspagay
    fkggikpvsvwlsheyvraspggtgaakfggnyaasllaqaqaaemgcdqvvwldaierr
    yveemggmnlffvfgsggsarlvtpelsgsllpgitrdsllqlatdagfaveerkidvde
    wqkkagageitevfacgtaavitpvshvkhhdgeftiadgqpgeitmalrdtltgiqrgt
    fadthgwmarln
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dtgB (B:)
    leftvsantnpatdavresilanpgfgkyytdhmvsidytvdegwhnaqvipygpiqldp
    saivlhygqeifeglkayrwadgsivsfrpeanaarlqssarrlaipelpeevfieslrq
    liavdekwvppaggeeslylrpfviatepglgvrpsneyrylliaspagayfkggikpvs
    vwlsheyvraspggtgaakfggnyaasllaqaqaaemgcdqvvwldaierryveemggmn
    lffvfgsggsarlvtpelsgsllpgitrdsllqlatdagfaveerkidvdewqkkagage
    itevfacgtaavitpvshvkhhdgeftiadgqpgeitmalrdtltgiqrgtfadthgwma
    rln