PDB entry 3dsr

View 3dsr on RCSB PDB site
Description: ADP in transition binding site in the subunit B of the energy converter A1Ao ATP synthase
Class: hydrolase
Keywords: HYDROLASE, ATP synthesis, Hydrogen ion transport, Ion transport, Transport
Deposited on 2008-07-14, released 2009-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.201
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: V-type ATP synthase beta chain
    Species: Methanosarcina mazei [TaxId:2209]
    Gene: ATP Synthase
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dsra1, d3dsra2, d3dsra3
  • Chain 'B':
    Compound: V-type ATP synthase beta chain
    Species: Methanosarcina mazei [TaxId:2209]
    Gene: ATP Synthase
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dsrb1, d3dsrb2, d3dsrb3
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dsrA (A:)
    mkhhhhhhpmvkeyktitqiagplifvektepvgyneivnikmgdgtvrrgqvldssadi
    vvvqvfegtggldkdcgviftgetlklpasvdllgrilsgsgeprdggprivpdqlldin
    gaamnpyarlppkdfiqtgistidgtntlvrgqklpifsasglphneialqiarqasvpg
    sesafavvfaamgitneeaqyfmsdfektgaleravvflnladdpaverivtprmaltaa
    eylayehgmhvlviltditnyaealrqmgaarnevpgrrgypgymytdlatlyeragivk
    gakgsvtqipilsmpgddithpipdlsgyitegqivvarelhrkgiyppinvlpslsrlm
    nsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedkf
    vrqgrnenrtiedtleigwqilthlpenqlgridnkyiqkyhpahrkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dsrA (A:)
    agplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegiftgetlklpas
    vdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistidgtntlv
    rgqklpifsasglphneialqiarqasvpgsesafavvfaamgitneeaqyfmsdfektg
    aleravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaealrqmga
    pgymytdlatlyeragivkgakgsvtqipilsmppipdlsgyitegqivvarelhrkgiy
    ppinvlpslsrlmnsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdt
    kflefadlfedkfvrqgrnenrtiedtleigwqilthlpenqlgridnkyiqkyhpahr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dsrB (B:)
    mkhhhhhhpmvkeyktitqiagplifvektepvgyneivnikmgdgtvrrgqvldssadi
    vvvqvfegtggldkdcgviftgetlklpasvdllgrilsgsgeprdggprivpdqlldin
    gaamnpyarlppkdfiqtgistidgtntlvrgqklpifsasglphneialqiarqasvpg
    sesafavvfaamgitneeaqyfmsdfektgaleravvflnladdpaverivtprmaltaa
    eylayehgmhvlviltditnyaealrqmgaarnevpgrrgypgymytdlatlyeragivk
    gakgsvtqipilsmpgddithpipdlsgyitegqivvarelhrkgiyppinvlpslsrlm
    nsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedkf
    vrqgrnenrtiedtleigwqilthlpenqlgridnkyiqkyhpahrkak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dsrB (B:)
    iagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegviftgetlklp
    asvdllgrilsgsgeprdggprivpdqlldingaamnpyarlppkdfiqtgistidgtnt
    lvrgqklpifsasglphneialqiarqasvpgsesafavvfaamgitneeaqyfmsdfek
    tgaleravvflnladdpaverivtprmaltaaeylayehgmhvlviltditnyaealrqm
    gaarrgypgymytdlatlyeragivkgakgsvtqipilsmhpipdlsgyitegqivvare
    lhrkgiyppinvlpslsrlmnsgigagktredhkavsdqmyagyaegrdlrglvaivgke
    alserdtkflefadlfedkfvrqgrnenrtiedtleigwqilthlpenqlgridnkyiqk
    yhpah