PDB entry 3dpl

View 3dpl on RCSB PDB site
Description: Structural Insights into NEDD8 Activation of Cullin-RING Ligases: Conformational Control of Conjugation.
Class: ligase
Keywords: ubiquitin, NEDD8, cullin, Host-virus interaction, Receptor, Ubl conjugation, Ubl conjugation pathway, Acetylation, Cytoplasm, DNA damage, DNA repair, Metal-binding, Nucleus, Zinc, Zinc-finger, LIGASE
Deposited on 2008-07-08, released 2008-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.244
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'C':
  Compound: Cullin-5
  Species: Homo sapiens [TaxId:9606]
  Gene: CUL5, VACM1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q93034 (2-381)
    • engineered (8)
    • engineered (40-41)
• Chain 'R':
  Compound: RING-box protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: RBX1, RNF75, ROC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62877 (Start-105)
  Domains in SCOPe 2.08: d3dplr_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'C':
  No sequence available.
  
  
• Chain 'R':
  Sequence, based on SEQRES records: (download)
  

  >3dplR (R:)
  gsmdvdtpsgtnsgagkkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqas
  atseectvawgvcnhafhfhcisrwlktrqvcpldnrewefqkygh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3dplR (R:)
  kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasaectvawgvcnhafhf
  hcisrwlktrqvcpldnrewefqkygh