PDB entry 3dpf

View 3dpf on RCSB PDB site
Description: Crystal structure of the complex between MMP-8 and a non-zinc chelating inhibitor
Class: hydrolase
Keywords: hydrolase, selective inhibition, non-zinc chelating inhibitors, Calcium, Collagen degradation, Extracellular matrix, Glycoprotein, Metal-binding, Metalloprotease, Polymorphism, Protease, Secreted, Zinc, Zymogen
Deposited on 2008-07-08, released 2009-03-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil collagenase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP8, CLG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dpfa_
  • Chain 'B':
    Compound: Neutrophil collagenase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP8, CLG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3dpfb_
  • Heterogens: CA, ZN, AXB, HAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3dpfA (A:)
mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin
iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef
ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3dpfB (B:)
mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin
iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef
ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg