PDB entry 3dp5

View 3dp5 on RCSB PDB site
Description: Crystal structure of Geobacter sulfurreducens OmcF with N-terminal Strep-tag II
Class: electron transport
Keywords: c-type cytochrome, Fe SAD phasing, dissimilatory metal reduction, Geobacter sulfurreducens, ELECTRON TRANSPORT
Deposited on 2008-07-07, released 2008-09-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.172
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c family protein
    Species: Geobacter sulfurreducens [TaxId:35554]
    Gene: GSU2432
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q74AE4 (20-98)
      • expression tag (0-19)
    Domains in SCOPe 2.04: d3dp5a_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dp5A (A:)
    aaswshpqfekgaetavpnsgggelfathcagchpqggntvhpektlararreangirtv
    rdvaayirnpgpgmpafgeamippadalkigeyvvasfp