PDB entry 3doe

View 3doe on RCSB PDB site
Description: Complex of ARL2 and BART, Crystal Form 1
Class: signaling protein/hydrolase
Keywords: ADP-ribosylation factor-like 2, binder of ARL2, small GTPase, effector, complex structure, GTP-binding, Lipoprotein, Myristate, Nucleotide-binding, Polymorphism, Alternative splicing, Cytoplasm, Mitochondrion, Phosphoprotein, SIGNALING PROTEIN/HYDROLASE complex
Deposited on 2008-07-04, released 2009-03-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.232
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36404 (Start-183)
      • expression tag (184-189)
    Domains in SCOPe 2.05: d3doea_
  • Chain 'B':
    Compound: ADP-ribosylation factor-like protein 2-binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3doeA (A:)
    mglltilkkmkqkerelrllmlgldnagkttilkkfngedidtisptlgfniktlehrgf
    klniwdvggqkslrsywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagatl
    lifankqdlpgalssnairevleldsirshhwciqgcsavtgenllpgidwllddissri
    ftadlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3doeA (A:)
    glltilkkmkqkerelrllmlgldnagkttilkkfngedidtisptlgfniktlehrgfk
    lniwdvggqkslrsywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagatll
    ifankqdlpgalssnairevleldsirshhwciqgcsavtgenllpgidwllddissrif
    tadlehhhh
    

  • Chain 'B':
    No sequence available.