PDB entry 3do6

View 3do6 on RCSB PDB site
Description: Crystal structure of Putative Formyltetrahydrofolate Synthetase (TM1766) from THERMOTOGA MARITIMA at 1.85 A resolution
Class: ligase
Keywords: TM1766, Putative Formyltetrahydrofolate Synthetase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, ATP-binding, Ligase, Nucleotide-binding, One-carbon metabolism
Deposited on 2008-07-03, released 2008-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Formate--tetrahydrofolate ligase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: fhs, TM_1766
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X287 (1-542)
      • leader sequence (0)
    Domains in SCOPe 2.07: d3do6a1, d3do6a2
  • Chain 'B':
    Compound: Formate--tetrahydrofolate ligase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: fhs, TM_1766
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X287 (1-542)
      • leader sequence (0)
    Domains in SCOPe 2.07: d3do6b1, d3do6b2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3do6A (A:)
    gmkpikeiadqlelkddilypyghyiakidhrflkslenhedgklilvtavtptpagegk
    tttsiglsmslnrigkksivtlrepslgptlglkggatgggrsrvlpsdeinlhftgdmh
    avasahnllaavldshikhgnelkiditrvfwkrtmdmndralrsiviglggsangfpre
    dsfiitaasevmailalsenmkdlkerlgkiivaldadrkivrisdlgiqgamavllkda
    inpnlvqttegtpalihcgpfaniahgtnsiiatkmamklseytvteagfgadlgaekfi
    dfvsrvggfypnaavlvatvralkyhgganlkniheenlealkegfknlrvhvenlrkfn
    lpvvvalnrfstdtekeiayvvkeceklgvrvavsevfkkgseggvelakavaeaakdve
    paylyemndpvekkieilakeiyragrvefsdtaknalkfikkhgfdelpvivaktpksi
    shdpslrgapegytfvvsdlfvsagagfvvalsgdinlmpglpkkpnalnmdvddsgniv
    gvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3do6B (B:)
    gmkpikeiadqlelkddilypyghyiakidhrflkslenhedgklilvtavtptpagegk
    tttsiglsmslnrigkksivtlrepslgptlglkggatgggrsrvlpsdeinlhftgdmh
    avasahnllaavldshikhgnelkiditrvfwkrtmdmndralrsiviglggsangfpre
    dsfiitaasevmailalsenmkdlkerlgkiivaldadrkivrisdlgiqgamavllkda
    inpnlvqttegtpalihcgpfaniahgtnsiiatkmamklseytvteagfgadlgaekfi
    dfvsrvggfypnaavlvatvralkyhgganlkniheenlealkegfknlrvhvenlrkfn
    lpvvvalnrfstdtekeiayvvkeceklgvrvavsevfkkgseggvelakavaeaakdve
    paylyemndpvekkieilakeiyragrvefsdtaknalkfikkhgfdelpvivaktpksi
    shdpslrgapegytfvvsdlfvsagagfvvalsgdinlmpglpkkpnalnmdvddsgniv
    gvs