PDB entry 3dlt

View 3dlt on RCSB PDB site
Description: Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism
Class: hydrolase
Keywords: alpha beta hydrolase, mechanism, catalytic triad, rotation, esterase
Deposited on 2008-06-29, released 2009-06-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Esterase D
    Species: Lactobacillus rhamnosus [TaxId:486408]
    Gene: EstD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3dlta_
  • Heterogens: BUA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dltA (A:)
    gamgirnsifrkpqpfeyegtdtgvvllhaytgspndmnfmaralqrsgygvyvplfsgh
    gtvepldiltkgnpdiwwaessaavahmtakyakvfvfglslggifamkaletlpgitag
    gvfsspilpgkhhlvpgflkyaeymnrlagksdestqilaylpgqlaaidqfattvaadl
    nlvkqptfigqagqdelvdgrlayqlrdalinaarvdfhwyddakhvitvnsahhaleed
    viafmqqeneg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dltA (A:)
    frkpqpfeyegtdtgvvllhaytgspndmnfmaralqrsgygvyvplfsghgtvepldil
    tkgnpdiwwaessaavahmtakyakvfvfglslggifamkaletlpgitaggvfsspilp
    gkhhlvpgflkyaeymnrlagksdestqilaylpgqlaaidqfattvaadlnlvkqptfi
    gqagqdelvdgrlayqlrdalinaarvdfhwyddakhvitvnsahhaleedviafmqqe