PDB entry 3dl7

View 3dl7 on RCSB PDB site
Description: Aged Form of Mouse Acetylcholinesterase Inhibited by Tabun- Update
Class: hydrolase
Keywords: hydrolase, tabun, organophosphate, aging, Cell junction, Glycoprotein, GPI-anchor, Lipoprotein, Membrane, Neurotransmitter degradation, Secreted, Serine esterase, Synapse
Deposited on 2008-06-26, released 2008-12-02
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21836 (0-542)
      • microheterogeneity (202)
      • microheterogeneity (202)
    Domains in SCOPe 2.02: d3dl7a_
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21836 (Start-542)
      • microheterogeneity (202)
      • microheterogeneity (202)
      • see remark 999 (543)
    Domains in SCOPe 2.02: d3dl7b_
  • Heterogens: NAG, CL, P6G, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dl7A (A:)
    egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
    dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
    ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
    qwvqeniaafggdpmsvtlfgexagaasvgmhilslpsrslfhravlqsgtpngpwatvs
    agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
    pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqfl
    agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
    qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
    tnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
    satateap
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dl7A (A:)
    egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
    dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
    ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
    qwvqeniaafggdpmsvtlfgexagaasvgmhilslpsrslfhravlqsgtpngpwatvs
    agearrratllarlvgcpndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgd
    flsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrig
    vpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvy
    ayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfart
    gdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dl7B (B:)
    egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
    dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
    ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
    qwvqeniaafggdpmsvtlfgexagaasvgmhilslpsrslfhravlqsgtpngpwatvs
    agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
    pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqfl
    agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
    qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
    tnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
    satateap
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dl7B (B:)
    edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
    tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
    ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
    qeniaafggdpmsvtlfgexagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
    arrratllarlvgcndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdflsd
    tpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrigvpqa
    sdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvyayif
    ehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartgdpn
    dprdsspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsata