PDB entry 3dl2

View 3dl2 on RCSB PDB site
Description: Hexagonal structure of the LDH domain of Human Ubiquitin-conjugating Enzyme E2-like Isoform A
Class: structural genomics, unknown function
Keywords: L-LACTATE DEHYDROGENASE, OXIDOREDUCTASE, UBIQUITIN-PROTEIN LIGASE, Alternative splicing, NAD, Ubl conjugation pathway, Structural Genomics, Structural Genomics Consortium, SGC, UNKNOWN FUNCTION
Deposited on 2008-06-26, released 2008-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 variant 3
    Species: Homo sapiens [TaxId:9606]
    Gene: UEVLD, UEV3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IX04 (2-302)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3dl2a1, d3dl2a2, d3dl2a3
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 variant 3
    Species: Homo sapiens [TaxId:9606]
    Gene: UEVLD, UEV3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IX04 (2-302)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3dl2b1, d3dl2b2, d3dl2b3
  • Heterogens: NA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dl2A (A:)
    gsskswanhenktvnkitvvgggelgiactlaisakgiadrlvlldlsegtkgatmdlei
    fnlpnveiskdlsasahskvviftvnslgssqsyldvvqsnvdmfralvpalghysqhsv
    llvasqpveimtyvtwklstfpanrvigigcnldsqrlqyiitnvlkaqtsgkevwvige
    qgedkvltwsgqeevvshtsqvqlsnramellrvkgqrswsvglsvadmvdsivnnkkkv
    hsvsalakgyydinsevflslpcilgtngvsevikttlkedtvteklqssassihslqqq
    lkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dl2A (A:)
    gsskstvnkitvvgggelgiactlaisakgiadrlvlldlsegtkgatmdleifnlpnve
    iskdlsasahskvviftvnsqsyldvvqsnvdmfralvpalghysqhsvllvasqpveim
    tyvtwklstfpanrvigigcnldsqrlqyiitnvlkaqtsgkevwvigeqgedkvltwsg
    eevvshtsqvqlsnramellrvkgqrswsvglsvadmvdsivnnkkkvhsvsalakgyyd
    insevflslpcilgtngvsevikttldtvteklqssassihslqqqlkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dl2B (B:)
    gsskswanhenktvnkitvvgggelgiactlaisakgiadrlvlldlsegtkgatmdlei
    fnlpnveiskdlsasahskvviftvnslgssqsyldvvqsnvdmfralvpalghysqhsv
    llvasqpveimtyvtwklstfpanrvigigcnldsqrlqyiitnvlkaqtsgkevwvige
    qgedkvltwsgqeevvshtsqvqlsnramellrvkgqrswsvglsvadmvdsivnnkkkv
    hsvsalakgyydinsevflslpcilgtngvsevikttlkedtvteklqssassihslqqq
    lkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dl2B (B:)
    gssksvnkitvvgggelgiactlaisakgiadrlvlldlsegtkgatmdleifnlpnvei
    skdlsasahskvviftvnsqsyldvvqsnvdmfralvpalghysqhsvllvasqpveimt
    yvtwklstfpanrvigigcnldsqrlqyiitnvlkaqtkevwvigeqgedkvltwsgqee
    vvshtsqvqlsnramellrvkgqrswsvglsvadmvdsivnnkkkvhsvsalakgyydin
    sevflslpcilgtngvseviktlkdtvteklqssassihslqqqlkl