PDB entry 3dkp

View 3dkp on RCSB PDB site
Description: Human DEAD-box RNA-helicase DDX52, conserved domain I in complex with ADP
Class: hydrolase
Keywords: RNA HELICASE, DEAD, ADP, Structural Genomics, Structural Genomics Consortium, SGC, rRNA, ATP-binding, Hydrolase, Nucleotide-binding, Nucleus, Phosphoprotein, RNA-binding
Deposited on 2008-06-25, released 2008-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.185
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ATP-dependent RNA helicase DDX52
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX52, ROK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y2R4 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3dkpa1, d3dkpa2
  • Heterogens: MG, ADP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dkpA (A:)
    smkinflrnkhkihvqgtdlpdpiatfqqldqeykinsrllqnildagfqmptpiqmqai
    pvmlhgrellasaptgsgktlafsipilmqlkqpankgfraliisptrelasqihrelik
    isegtgfrihmihkaavaakkfgpksskkfdilvttpnrliyllkqdppgidlasvewlv
    vdesdklfedgktgfrdqlasiflactshkvrramfsatfaydveqwcklnldnvisvsi
    garns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dkpA (A:)
    smkinflrnkhkihvqgtdlpdpiatfqqldqeykinsrllqnildagfqmptpiqmqai
    pvmlhgrellasaptgsgktlafsipilmqlkqpankgfraliisptrelasqihrelik
    isegtgfrihmihkaavaakkfgpksskkfdilvttpnrliyllkqdppgidlasvewlv
    vdesdklfedggfrdqlasiflactshkvrramfsatfaydveqwcklnldnvisvsiga