PDB entry 3dkc

View 3dkc on RCSB PDB site
Description: SGX CLONE 5698a65KFg1h1
Class: oncoprotein
Keywords: DRUG DISCOVERY, c-MET KINASE, FRAGMENT BASED, Membrane, Receptor, Transmembrane, ONCOPROTEIN
Deposited on 2008-06-24, released 2009-07-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-01-19, with a file datestamp of 2010-01-15.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.189
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Met proto-oncogene
    Species: Homo sapiens [TaxId:9606]
    Gene: MET, hCG_38705, tcag7.66
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1L467 (Start-314)
      • engineered (148)
      • engineered (188-189)
      • expression tag (315-316)
    Domains in SCOPe 2.02: d3dkca_
  • Heterogens: MG, CL, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dkcA (A:)
    gslntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkki
    hcavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdl
    rnfirnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfgl
    ardmydkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappyp
    dvntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfi
    gehyvhvnatyvnvkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dkcA (A:)
    vhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavk
    slnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfir
    nethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmy
    dkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntf
    ditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyv
    hvnatyvnvkeg