PDB entry 3djf

View 3djf on RCSB PDB site
Description: Crystal Structure of Schistosoma mansoni Purine Nucleoside Phosphorylase in a complex with BCX-34
Class: transferase
Keywords: Purine Nucleoside Phosphorylase, BCX34, Inhibitor, Glycosyltransferase, Transferase
Deposited on 2008-06-23, released 2009-06-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3djfa_
  • Chain 'B':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3djfb_
  • Chain 'C':
    Compound: purine-nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3djfc_
  • Heterogens: SO4, DMS, BC3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3djfA (A:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3djfA (A:)
    vtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqtshs
    gnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaagglnrslk
    lgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaeengfgn
    lvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavslvtnis
    vldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3djfB (B:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3djfB (B:)
    svtanienvkkvahhiqkltsivpeigiicgsgladgvkdkitipytkipnfpqtsvvgh
    sgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaagglnrsl
    klgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaeengfg
    nlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavslvtni
    svldvesaqraelmqswfekiieklpkd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3djfC (C:)
    mhesvtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpq
    tsvvghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaag
    glnrslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqva
    eengfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfav
    slvtnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3djfC (C:)
    svtanienvkkvahhiqkltsivpeigiicgsglgkladgvkdkitipytkipnfpqtsv
    vghsgnlifgtlsgrkvvvmqgrfhmyegysndtvalpirvmkllgvkilmvsnaaggln
    rslklgdfvilkdhiylpglglnnilvgpnqeafgtrfpalsnaydrdlrklavqvaeen
    gfgnlvhqgvyvmnggpcyetpaectmllnmgcdvvgmstipevviarhcgiqvfavslv
    tnisvldvesdlkpnheevlatgaqraelmqswfekiieklpkd