PDB entry 3dj9

View 3dj9 on RCSB PDB site
Description: Crytal Structure of an isolated, unglycosylated antibody CH2 domain
Class: immune system
Keywords: antibody, immunoglobulin, CH2 domain, Glycoprotein, Immunoglobulin C region, Immunoglobulin domain, Secreted, IMMUNE SYSTEM
Deposited on 2008-06-22, released 2008-09-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.203
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3dj9a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dj9A (A:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgq