PDB entry 3die

View 3die on RCSB PDB site
Description: Domain swapping of Staphylococcus Aureus thioredoxin W28A mutant
Class: electron transport
Keywords: ELECTRON TRANSPORT, SWAP DOMAIN, redox enzymology, oxidoreductase, Redox-active center, Transport
Deposited on 2008-06-20, released 2009-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.193
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: trxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0K6 (2-105)
      • expression tag (0-1)
      • engineered (29)
    Domains in SCOPe 2.07: d3diea1, d3diea2
  • Chain 'B':
    Compound: thioredoxin
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: trxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0K6 (2-105)
      • expression tag (0-1)
      • engineered (29)
    Domains in SCOPe 2.07: d3dieb1, d3dieb2
  • Heterogens: CD, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dieA (A:)
    shmaivkvtdadfdskvesgvqlvdfwatacgpckmiapvleelaadyegkadilkldvd
    enpstaakyevmsiptlivfkdgqpvdkvvgfqpkenlaevldkhl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dieB (B:)
    shmaivkvtdadfdskvesgvqlvdfwatacgpckmiapvleelaadyegkadilkldvd
    enpstaakyevmsiptlivfkdgqpvdkvvgfqpkenlaevldkhl