PDB entry 3dhz

View 3dhz on RCSB PDB site
Description: Apo (iron free) structure of C. ammoniagenes R2 protein
Class: Metal Binding Protein
Keywords: metal free, ribonucleotide reductase, hydrogen bond, Metal Binding Protein
Deposited on 2008-06-19, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.165
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleotide reductase subunit R2F
    Species: Corynebacterium ammoniagenes [TaxId:1697]
    Gene: nrdF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dhza_
  • Chain 'B':
    Compound: Ribonucleotide reductase subunit R2F
    Species: Corynebacterium ammoniagenes [TaxId:1697]
    Gene: nrdF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dhzb_
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dhzA (A:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dhzA (A:)
    neydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpqe
    qlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmtl
    astpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmyl
    ssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlyen
    eieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dhzB (B:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dhzB (B:)
    sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
    eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
    lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
    lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
    neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls