PDB entry 3dhx

View 3dhx on RCSB PDB site
Description: Crystal structure of isolated C2 domain of the methionine uptake transporter
Class: hydrolase
Keywords: Methionine uptake, regulation, Amino-acid transport, ATP-binding, Hydrolase, Inner membrane, Membrane, Nucleotide-binding, Transport
Deposited on 2008-06-18, released 2008-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.193
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine import ATP-binding protein metN
    Species: Escherichia coli [TaxId:83333]
    Gene: metN, abc, b0199, JW0195
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30750 (Start-97)
      • expression tag (98-99)
    Domains in SCOPe 2.08: d3dhxa1, d3dhxa2
  • Chain 'B':
    Compound: Methionine import ATP-binding protein metN
    Species: Escherichia coli [TaxId:83333]
    Gene: metN, abc, b0199, JW0195
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30750 (Start-97)
      • expression tag (98-99)
    Domains in SCOPe 2.08: d3dhxb2, d3dhxb3
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3dhxA (A:)
hldipedyqerlqaepftdcvpmlrleftgqsvdapllsetarrfnvnnniisaqmdyag
gvkfgimltemhgtqqdtqaaiawlqehhvkvevlgyvlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3dhxA (A:)
ldipedyqerlqaepftdcvpmlrleftgqsvdapllsetarrfnvnnniisaqmdyagg
vkfgimltemhgtqqdtqaaiawlqehhvkvevlgyvle

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3dhxB (B:)
hldipedyqerlqaepftdcvpmlrleftgqsvdapllsetarrfnvnnniisaqmdyag
gvkfgimltemhgtqqdtqaaiawlqehhvkvevlgyvlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3dhxB (B:)
ldipedyqerlqaepftdcvpmlrleftgqsvdapllsetarrfnvnnniisaqmdyagg
vkfgimltemhgtqqdtqaaiawlqehhvkvevlgyvle