PDB entry 3dgg

View 3dgg on RCSB PDB site
Description: Crystal structure of FabOX108
Class: immune system
Keywords: Antibody fragments, Fabs, Transient expression, Structural Genomics, Oxford Protein Production Facility, OPPF, Immunoglobulin domain, IMMUNE SYSTEM
Deposited on 2008-06-13, released 2008-08-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FabOX108 Light Chain Fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DGG (0-216)
    Domains in SCOPe 2.05: d3dgga1, d3dgga2
  • Chain 'B':
    Compound: FabOX108 Heavy Chain Fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DGG (0-End)
    Domains in SCOPe 2.05: d3dggb1
  • Chain 'C':
    Compound: FabOX108 Light Chain Fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DGG (0-End)
    Domains in SCOPe 2.05: d3dggc1, d3dggc2
  • Chain 'D':
    Compound: FabOX108 Heavy Chain Fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DGG (0-End)
    Domains in SCOPe 2.05: d3dggd1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dggA (A:)
    divltqspaslavslgqratiscrasksvstsgysymhwyqqkpgqppklliylasnles
    gvparfsgsgsgtdftlnihpveeedaatyycqhsrelltfgagtklelkradaaptvsi
    fppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmss
    tltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dggB (B:)
    evklqqsgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpynddtny
    nekfkgkatltsdkssstaymelssltsedsavyycaredyygsrwgywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcgkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dggB (B:)
    evklqqsgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpynddtny
    nekfkgkatltsdkssstaymelssltsedsavyycaredyygsrwgywgqgttltvssa
    kttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
    tvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dggC (C:)
    divltqspaslavslgqratiscrasksvstsgysymhwyqqkpgqppklliylasnles
    gvparfsgsgsgtdftlnihpveeedaatyycqhsrelltfgagtklelkradaaptvsi
    fppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmss
    tltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dggC (C:)
    divltqspaslavslgqratiscrasksvstsgysymhwyqqkpgqppklliylasnles
    gvparfsgsgsgtdftlnihpveeedaatyycqhsrelltfgagtklelkradaaptvsi
    fppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmss
    tltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dggD (D:)
    evklqqsgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpynddtny
    nekfkgkatltsdkssstaymelssltsedsavyycaredyygsrwgywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcgkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dggD (D:)
    evklqqsgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpynddtny
    nekfkgkatltsdkssstaymelssltsedsavyycaredyygsrwgywgqgttltvssa
    kttppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsetvtcnvahpasstkvdkkivprd