PDB entry 3dgf

View 3dgf on RCSB PDB site
Description: Structure of a histidine kinase-response regulator complex reveals insights into Two-component signaling and a novel cis-autophosphorylation mechanism
Class: signaling protein
Keywords: receiver domain, SIGNALING PROTEIN
Deposited on 2008-06-13, released 2009-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Response regulator
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_0468
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dgfc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dgfC (C:)
    mskkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmd
    gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
    ne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dgfC (C:)
    skkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmdg
    ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln