PDB entry 3dge

View 3dge on RCSB PDB site
Description: Structure of a histidine kinase-response regulator complex reveals insights into Two-component signaling and a novel cis-autophosphorylation mechanism
Class: transferase/signaling protein
Keywords: four-helix bundle, ATP binding domain, receiver domain, Kinase, Phosphoprotein, TRANSFERASE, TRANSFERASE-SIGNALING PROTEIN COMPLEX
Deposited on 2008-06-13, released 2009-07-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_0853
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dgea1
  • Chain 'B':
    Compound: Sensor protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_0853
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dgeb1, d3dgeb2
  • Chain 'C':
    Compound: Response regulator
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_0468
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dgec_
  • Chain 'D':
    Compound: Response regulator
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM_0468
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dged_
  • Heterogens: SO4, ADP, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dgeA (A:)
    venvteskelerlkridrmktefianishelrtpltaikayaetiynslgeldlstlkef
    leviidqsnhlenllnelldfsrlerkslqinrekvdlcdlvesavnaikefasshnvnv
    lfesnvpcpveayidptrirqvllnllnngvkyskkdapdkyvkvildekdggvliived
    ngigipdhakdrifeqfyrvdssltyevpgtglglaitkeivelhggriwvesevgkgsr
    ffvwipkdragednrqdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dgeA (A:)
    kridrmktefianishelrtpltaikayaetiynslgeldlstlkefleviidqsnhlen
    llnelldfsrlerkslqinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpveay
    idptrirqvllnllnngvkyskkdapdkyvkvildekdggvliivedngigipdhakdri
    feqfyrvdssltyevpgtglglaitkeivelhggriwvesevgkgsrffvwipkdra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dgeB (B:)
    venvteskelerlkridrmktefianishelrtpltaikayaetiynslgeldlstlkef
    leviidqsnhlenllnelldfsrlerkslqinrekvdlcdlvesavnaikefasshnvnv
    lfesnvpcpveayidptrirqvllnllnngvkyskkdapdkyvkvildekdggvliived
    ngigipdhakdrifeqfyrvdssltyevpgtglglaitkeivelhggriwvesevgkgsr
    ffvwipkdragednrqdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dgeB (B:)
    kridrmktefianishelrtpltaikayaetiynslgeldlstlkefleviidqsnhlen
    llnelldfsrlerkslqinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpveay
    idptrirqvllnllnngvkyskkdapdkyvkvildekdggvliivedngigipdhakdri
    feqfyrvdssltyevpgtglglaitkeivelhggriwvesevgkgsrffvwipkdra
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dgeC (C:)
    mskkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmd
    gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
    ne
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dgeD (D:)
    mskkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmd
    gftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhll
    ne