PDB entry 3dgb

View 3dgb on RCSB PDB site
Description: Crystal structure of muconate lactonizing enzyme from Pseudomonas Fluorescens complexed with muconolactone
Class: isomerase
Keywords: muconate lactonizing enzyme, muconolactone binding, Isomerase, Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2008-06-13, released 2009-03-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.189
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muconate cycloisomerase
    Species: Pseudomonas fluorescens [TaxId:220664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dgba1, d3dgba2
  • Heterogens: MG, MUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dgbA (A:)
    mslhasaiesietiivdlptirphklamhtmqnqtlvlirlrcadgieglgesttiggla
    ygnespdsiktnidrfvaplligqdasninaamlrleqsirgntfaksgiesalldaqgk
    rlglpvsellggrvrdalpvawtlasgdtakdiaeaqkmldlrrhrifklkigagevdrd
    lahviaikkalgdsasvrvdvnqawdeavalracrilggngidlieqpisrnnragmvrl
    nasspapimadesiecvedafnlaregaasvfalkiaknggpratlrtaaiaeaagigly
    ggtmleggigtlasahafltlnklswdtelfgpllltedilaeppvyrdfhlhvskapgl
    glsldeerlaffrreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dgbA (A:)
    hasaiesietiivdlptirphklamhtmqnqtlvlirlrcadgieglgesttigglaygn
    espdsiktnidrfvaplligqdasninaamlrleqsirgntfaksgiesalldaqgkrlg
    lpvsellggrvrdalpvawtlasgdtakdiaeaqkmldlrrhrifklkigagevdrdlah
    viaikkalgdsasvrvdvnqawdeavalracrilggngidlieqpisrnnragmvrlnas
    spapimadesiecvedafnlaregaasvfalkiaknggpratlrtaaiaeaagiglyggt
    mleggigtlasahafltlnklswdtelfgpllltedilaeppvyrdfhlhvskapglgls
    ldeerlaffrr