PDB entry 3dg3

View 3dg3 on RCSB PDB site
Description: Crystal structure of muconate lactonizing enzyme from Mucobacterium Smegmatis
Class: isomerase
Keywords: muconate lactonizing enzyme, muconolactone binding, Isomerase
Deposited on 2008-06-12, released 2009-03-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.189
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muconate cycloisomerase
    Species: MYCOBACTERIUM SMEGMATIS [TaxId:246196]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dg3a1, d3dg3a2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dg3A (A:)
    mkivaigaipfsipytkplrfasgevhaaehvlvrvhtddgivgvaeapprpftygetqt
    givavieqyfapaligltlterevahtrmartvgnptakaaidmamwdalgqslrlsvse
    mlggytdrmrvshmlgfddpvkmvaeaeriretygintfkvkvgrrpvqldtavvralre
    rfgdaielyvdgnrgwsaaeslramremadldllfaeelcpaddvlsrrrlvgqldmpfi
    adesvptpadvtrevlggsataisiktartgftgstrvhhlaeglgldmvmgnqidgqig
    tactvsfgtafertsrhagelsnfldmsddlltvplqisdgqlhrrpgpglgieidpdkl
    ahyrtdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dg3A (A:)
    mkivaigaipfsipytaaehvlvrvhtddgivgvaeapprpftygetqtgivavieqyfa
    paligltlterevahtrmartvgnptakaaidmamwdalgqslrlsvsemlggytdrmrv
    shmlgfddpvkmvaeaeriretygintfkvkvgrrpvqldtavvralrerfgdaielyvd
    gnrgwsaaeslramremadldllfaeelcpaddvlsrrrlvgqldmpfiadesvptpadv
    trevlggsataisiktartgftgstrvhhlaeglgldmvmgnqidgqigtactvsfgtaf
    ertsrhagelsnfldmsddlltvplqisdgqlhrrpgpglgieidpdklahyrtd