PDB entry 3df8

View 3df8 on RCSB PDB site
Description: The crystal structure of a possible HxlR family transcriptional factor from Thermoplasma volcanium GSS1
Class: transcription
Keywords: APC89000, HxlR, transcriptional factor, structural genomics, PSI-2, midwest center for structural genomics, MCSG, Protein Structure Initiative, TRANSCRIPTION
Deposited on 2008-06-11, released 2008-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.173
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: possible HxlR family transcriptional factor
    Species: Thermoplasma volcanium [TaxId:50339]
    Gene: TV1295, TVG1336486
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q978X0 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d3df8a1, d3df8a2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3df8A (A:)
    snamlrygdteicidpsesvlhllgkkytmliisvlgngstrqnfndirssipgisstil
    srrikdlidsglverrsgqittyaltekgmnvrnslmpllqyisvldrngd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3df8A (A:)
    snamlrygdteicidpsesvlhllgkkytmliisvlgngstrqnfndirssipgisstil
    srrikdlidsglverrsgqittyaltekgmnvrnslmpllqyisvldrn