PDB entry 3dep

View 3dep on RCSB PDB site
Description: Structural basis for specific substrate recognition by the chloroplast signal recognition particle protein cpSRP43
Class: protein transport, membrane protein
Keywords: Chloroplast SRP system, Signal recognition particle, signal sequence, ankyrin repeat, chromodomain, type I turn, substrate protein recognition, L18 region, LHCP, ANK repeat, Chloroplast, Coiled coil, Plastid, Ribonucleoprotein, PROTEIN TRANSPORT, MEMBRANE PROTEIN
Deposited on 2008-06-10, released 2008-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.252
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal recognition particle 43 kDa protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CAO, At2g47450, T30B22.25
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3depa1, d3depa2
  • Chain 'B':
    Compound: ypggsfdplgla
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3DEP (0-11)
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3depA (A:)
evnkiigsrtagegameyliewkdghspswvpssyiaadvvseyetpwwtaarkadeqal
sqlledrdvdavdengrtallfvaglgsdkcvrllaeagadldhrdmrggltalhmaagy
vrpevvealvelgadievedergltalelareilkttpkgnpmqfgrriglekvinvleg
qvf

  • Chain 'B':
    No sequence available.