PDB entry 3dem

View 3dem on RCSB PDB site
Description: CUB1-EGF-CUB2 domain of HUMAN MASP-1/3
Class: hydrolase
Keywords: complement system, innate immunity, calcium binding sites, Complement pathway, EGF-like domain, Glycoprotein, Hydrolase, Hydroxylation, Immune response, Protease, Serine protease, Sushi, Lectin
Deposited on 2008-06-10, released 2008-07-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.223
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement factor MASP-3
    Species: Homo sapiens [TaxId:9606]
    Gene: MASP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3dema1, d3dema2, d3dema3
  • Chain 'B':
    Compound: Complement factor MASP-3
    Species: Homo sapiens [TaxId:9606]
    Gene: MASP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3demb1, d3demb2, d3demb3
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3demA (A:)
    htvelnnmfgqiqspgypdsypsdsevtwnitvpdgfriklyfmhfnlessylceydyvk
    vetedqvlatfcgrettdteqtpgqevvlspgsfmsitfrsdfsneerftgfdahymavd
    vdeckeredeelscdhychnyiggyycscrfgyilhtdnrtcrvecsdnlftqrtgvits
    pdfpnpypksseclytieleegfmvnlqfedifdiedhpevpcpydyikikvgpkvlgpf
    cgekapepistqshsvlilfhsdnsgenrgwrlsyraa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3demA (A:)
    nmfgqiqspgypdsypsdsevtwnitvpdgfriklyfmhfnlessylceydyvkvetedq
    vlatfcgrettdteqtpgqevvlspgsfmsitfrsdfsneerftgfdahymavdvdecke
    lscdhychnyiggyycscrfgyilhtdnrtcrvecsdnlftqrtgvitspdfpnpypkss
    eclytieleegfmvnlqfedifdiedhpevpcpydyikikvgpkvlgpfcgekapepist
    qshsvlilfhsdnsgenrgwrlsyraa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3demB (B:)
    htvelnnmfgqiqspgypdsypsdsevtwnitvpdgfriklyfmhfnlessylceydyvk
    vetedqvlatfcgrettdteqtpgqevvlspgsfmsitfrsdfsneerftgfdahymavd
    vdeckeredeelscdhychnyiggyycscrfgyilhtdnrtcrvecsdnlftqrtgvits
    pdfpnpypksseclytieleegfmvnlqfedifdiedhpevpcpydyikikvgpkvlgpf
    cgekapepistqshsvlilfhsdnsgenrgwrlsyraa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3demB (B:)
    nmfgqiqspgypdsypsdsevtwnitvpdgfriklyfmhfnlessylceydyvkvetedq
    vlatfcgrettdqtpgqevvlspgsfmsitfrsdfsneerftgfdahymavdvdeckels
    cdhychnyiggyycscrfgyilhtdnrtcrvecsdnlftqrtgvitspdfpnpypkssec
    lytieleegfmvnlqfedifdiedhpevpcpydyikikvgpkvlgpfcgekapepistqs
    hsvlilfhsdnsgenrgwrlsyraa