PDB entry 3def

View 3def on RCSB PDB site
Description: Crystal structure of Toc33 from Arabidopsis thaliana, dimerization deficient mutant R130A
Class: hydrolase
Keywords: chloroplast, Toc33, GTPase, HYDROLASE
Deposited on 2008-06-10, released 2008-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.173
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T7I23.11 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: T7I23.11
    Database cross-references and differences (RAF-indexed):
    • Uniprot O23680
      • engineered (129)
    Domains in SCOPe 2.06: d3defa_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3defA (A:)
    mgslvrewvgfqqfpaatqeklieffgklkqkdmnsmtvlvlgkggvgksstvnsligeq
    vvrvspfqaeglrpvmvsrtmggftiniidtpglveagyvnhqalelikgflvnrtidvl
    lyvdrldvyavdeldkqvviaitqtfgkeiwcktllvlthaqfsppdelsyetfsskrsd
    sllktiragskmrkqefedsaiavvyaensgrcskndkdekalpngeawipnlvkaitdv
    atnqrkaihvdaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3defA (A:)
    rewvgfqqfpaatqeklieffgklkqkdmnsmtvlvlgkggvgksstvnsligeqvvrvs
    pfqaglrpvmvsrtmggftiniidtpglveagyvnhqalelikgflvnrtidvllyvdrl
    dvyavdeldkqvviaitqtfgkeiwcktllvlthaqfsppdelsyetfsskrsdsllkti
    ragskmrkqefedsaiavvyaensgrcskndkdekalpngeawipnlvkaitdvatnqrk
    aihv