PDB entry 3deb

View 3deb on RCSB PDB site
Description: Crystal Structure of apo form (Zinc removed) of the Botulinum Neurotoxin Type C Light Chain
Class: hydrolase
Keywords: BOTULISM, BOTULINUM NEUROTOXIN, APO FORM, LIGHT CHAIN, SNARE PROTEINS, PROTEASE, Hydrolase, Membrane, Metal-binding, Metalloprotease, Neurotoxin, Secreted, Toxin, Transmembrane, Zinc
Deposited on 2008-06-09, released 2009-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-07, with a file datestamp of 2009-04-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.194
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin C1 light chain
    Species: Clostridium botulinum [TaxId:1491]
    Gene: bont/C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18640 (20-449)
      • expression tag (18-19)
      • see remark 999 (104)
    Domains in SCOPe 2.07: d3deba1, d3deba2
  • Heterogens: NA, CA, ACT, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3debA (A:)
    mgsshhhhhhssglvprgshmpitinnfnysdpvdnknilyldthlntlanepekafrit
    gniwvipdrfsrnsnpnlnkpprvtspksgyydpnylstdsdkdtflkeiiklfkrinsr
    eigeeliyrlstdipfpgnnntpintfdfdvdfnsvdvktrqgnnwvktgsinpsviitg
    preniidpetstfkltnntfaaqegfgalsiisisprfmltysnatndvgegrfsksefc
    mdpililmhelnhamhnlygiaipndqtissvtsnifysqynvkleyaeiyafggptidl
    ipksarkyfeekaldyyrsiakrlnsittanpssfnkyigeykqklirkyrfvvessgev
    tvnrnkfvelyneltqiftefnyakiynvqnrkiylsnvytpvtanilddnvydiqngfn
    ipksnlnvlfmgqnlsrnpalrkvnpenml
    

    Sequence, based on observed residues (ATOM records): (download)
    >3debA (A:)
    shmpitinnfnysdpvdnknilyldthlntlanepekafritgniwvipdrfsrnsnpnl
    nkpprvtspksgyydpnylstdsdkdtflkeiiklfkrinsreigeeliyrlstdipfpg
    nnntpintfdfdvdfnsvdvktrqgnnwvktgsinpsviitgpreniidpetstfkltnn
    tfaaqegfgalsiisisprfmltysnatndvgegrfsksefcmdpililmhelnhamhnl
    ygiaipndqtissvtsnifysqynvkleyaeiyafggptidlipksarkyfeekaldyyr
    siakrlnsittanpssfnkyigeykqklirkyrfvvessgevtvnrnkfvelyneltqif
    tefnyakiynvqnrkiylsnvytpvtanilddnvydiqngfnipksnlnvlfmgqnlsrn
    palrkvnpenml