PDB entry 3ddu

View 3ddu on RCSB PDB site
Description: Prolyl Oligopeptidase with GSK552
Class: hydrolase
Keywords: POP, Prolyl Oligopeptidase, endopeptidase, HYDROLASE
Deposited on 2008-06-06, released 2008-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prolyl endopeptidase
    Species: Homo sapiens [TaxId:9606]
    Gene: PREP, PEP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48147 (0-708)
      • engineered (305)
      • engineered (317)
      • engineered (358)
      • engineered (372)
      • engineered (665)
    Domains in SCOPe 2.07: d3ddua1, d3ddua2
  • Heterogens: ACT, 552, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dduA (A:)
    lsfqypdvyrdetavqdyhghkicdpyawledpdseqtkafveaqnkitvpfleqcpirg
    lykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnilsd
    dgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawthd
    gkgmfynsypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggaels
    ddgryvllsiregcdpvnrlwycdlqqessgiagilkwvklidnfegeydyvtnegtvft
    fktnrhspnyrvinidftdpeeskwkvlvpehekdvlewiacvrsnflvlcylhdvkntl
    qlhdlttgallkifpldvgsivgysgqkkdteifyqftsflspgiiyhcdltkeeleprv
    frevtvkgidasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisit
    pnysvsrlifvrhmggilavanirgggeygetwhkggilankqncfddfqcaaeylikeg
    ytspkrltinggsnggllvaacanqrpdlfgcviaqvgvmdmlkfhkytighawttdygc
    sdskqhfewlvkysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivg
    rsrkqnnpllihvdtkaghgagkptakvieevsdmfafiarclnvdwip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dduA (A:)
    lsfqypdvyrdetavqdyhghkicdpyawledpdseqtkafveaqnkitvpfleqcpirg
    lykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnilsd
    dgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawthd
    gkgmfynsypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggaels
    ddgryvllsiregcdpvnrlwycdlqqessgiagilkwvklidnfegeydyvtnegtvft
    fktnrhspnyrvinidftdpeeskwkvlvpehekdvlewiacvrsnflvlcylhdvkntl
    qlhdlttgallkifpldvgsivgysgqkkdteifyqftsflspgiiyhcdltkeeleprv
    frevvkidasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpn
    ysvsrlifvrhmggilavanirgggeygetwhkggilankqncfddfqcaaeylikegyt
    spkrltinggsnggllvaacanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsd
    skqhfewlvkysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrs
    rkqnnpllihvdtkaghgagkptakvieevsdmfafiarclnvdwip