PDB entry 3dcu

View 3dcu on RCSB PDB site
Description: FXR with SRC1 and GSK8062
Class: transcription/transcription activator
Keywords: FXR, nuclear receptor, GW4064, alpha-helical sandwich, Activator, Alternative splicing, DNA-binding, Metal-binding, Nucleus, Receptor, Repressor, Transcription regulation, Zinc, Zinc-finger, Acyltransferase, Chromosomal rearrangement, Phosphoprotein, Polymorphism, Proto-oncogene, Transferase, Ubl conjugation, TRANSCRIPTION/TRANSCRIPTION ACTIVATOR COMPLEX
Deposited on 2008-06-04, released 2008-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.181
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bile acid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H4, BAR, FXR, HRR1, RIP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3dcua_
  • Chain 'B':
    Compound: Nuclear receptor coactivator 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: O62, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dcuA (A:)
    screkteltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqv
    lveftkklpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgi
    sdeyitpmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqk
    lckihqpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dcuA (A:)
    eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
    klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit
    pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
    penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq
    

  • Chain 'B':
    No sequence available.