PDB entry 3dcn

View 3dcn on RCSB PDB site
Description: Glomerella cingulata apo cutinase
Class: hydrolase
Keywords: Glomerella cingulata, cutinase, catalytic triad, Hydrolase, Secreted, Serine esterase
Deposited on 2008-06-04, released 2008-11-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-01-06, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cutinase
    Species: Glomerella cingulata [TaxId:5457]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11373 (7-200)
      • expression tag (5-6)
    Domains in SCOPe 2.06: d3dcna1, d3dcna2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dcnA (A:)
    amaisdpqsstrneletgsssacpkviyifarastepgnmgisagpivadaleriygand
    vwvqgvggpyladlasnflpdgtssaainearrlftlantkcpnaaivsggysqgtavma
    gsisglsttiknqikgvvlfgytknlqnlgripnfetsktevycdiadavcygtlfilpa
    hflyqtdaavaaprflqarig
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dcnA (A:)
    dpqsstrneletgsssacpkviyifarastepgnmgisagpivadaleriygandvwvqg
    vggpyladlasnflpdgtssaainearrlftlantkcpnaaivsggysqgtavmagsisg
    lsttiknqikgvvlfgytknlqnlgripnfetsktevycdiadavcygtlfilpahflyq
    tdaavaaprflqarig