PDB entry 3dcg
View 3dcg on RCSB PDB site
Description: Crystal Structure of the HIV Vif BC-box in Complex with Human ElonginB and ElonginC
Class: ligase/viral protein
Keywords: HIV, Vif, AIDS, Cytoplasm, Host-virus interaction, Membrane, Phosphoprotein, RNA-binding, Ubl conjugation, Ubl conjugation pathway, Virion, Acetylation, Nucleus, Transcription, Transcription regulation, LIGASE/VIRAL PROTEIN COMPLEX
Deposited on
2008-06-03, released
2008-07-08
The last revision prior to the SCOP 1.75 freeze date was dated
2008-08-26, with a file datestamp of
2008-08-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.188
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Transcription elongation factor B polypeptide 2
Species: Homo sapiens [TaxId:9606]
Gene: ElonginB
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d3dcga1 - Chain 'B':
Compound: Transcription elongation factor B polypeptide 1
Species: Homo sapiens [TaxId:9606]
Gene: ElonginC
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d3dcgb1 - Chain 'C':
Compound: Transcription elongation factor B polypeptide 2
Species: Homo sapiens [TaxId:9606]
Gene: ElonginB
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Transcription elongation factor B polypeptide 1
Species: Homo sapiens [TaxId:9606]
Gene: ElonginC
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d3dcgd1 - Chain 'E':
Compound: Virion infectivity factor
Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
Gene: Virion Infectivity Factor
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: Virion infectivity factor
Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
Gene: Virion Infectivity Factor
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3dcgA (A:)
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
Sequence, based on observed residues (ATOM records): (download)
>3dcgA (A:)
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafradtfealciepfssppelp
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3dcgB (B:)
mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
yftykvrytnssteipefpiapeialellmaanfldc
Sequence, based on observed residues (ATOM records): (download)
>3dcgB (B:)
myvklissdghefivkrehaltsgtikamltnevnfreipshvlskvcmyftykvrytns
eipefpiapeialellmaanfldc
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence, based on SEQRES records: (download)
>3dcgD (D:)
mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
yftykvrytnssteipefpiapeialellmaanfldc
Sequence, based on observed residues (ATOM records): (download)
>3dcgD (D:)
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.