PDB entry 3dcg

View 3dcg on RCSB PDB site
Description: Crystal Structure of the HIV Vif BC-box in Complex with Human ElonginB and ElonginC
Class: ligase/viral protein
Keywords: HIV, Vif, AIDS, Host-virus interaction, Membrane, Phosphoprotein, RNA-binding, Ubl conjugation pathway, Virion, Nucleus, Transcription, Transcription regulation, LIGASE-VIRAL PROTEIN COMPLEX
Deposited on 2008-06-03, released 2008-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.188
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ElonginB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dcga_
  • Chain 'B':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ElonginC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dcgb_
  • Chain 'C':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ElonginB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dcgc_
  • Chain 'D':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ElonginC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dcgd_
  • Chain 'E':
    Compound: Virion infectivity factor
    Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
    Gene: Virion Infectivity Factor
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Virion infectivity factor
    Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
    Gene: Virion Infectivity Factor
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dcgA (A:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dcgA (A:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafradtfealciepfssppelp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dcgB (B:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dcgB (B:)
    myvklissdghefivkrehaltsgtikamltnevnfreipshvlskvcmyftykvrytns
    eipefpiapeialellmaanfldc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dcgC (C:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dcgC (C:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafradtfealciepfssppe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3dcgD (D:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dcgD (D:)
    myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
    steipefpiapeialellmaanfldc
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.