PDB entry 3dcb

View 3dcb on RCSB PDB site
Description: Crystal structure of the Drosophila kinesin family member NOD in complex with AMPPNP
Class: motor protein
Keywords: kinesin, catalytic domain, ATPase, microtubule, AMPPNP, nucleotide-binding protein, ATP-binding, Coiled coil, Motor protein, Nucleotide-binding
Deposited on 2008-06-03, released 2009-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-10, with a file datestamp of 2009-02-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein Nod
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: nod, NODA, CG1763
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18105 (Start-332)
      • expression tag (333-335)
    Domains in SCOPe 2.07: d3dcba1, d3dcba2
  • Heterogens: MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dcbA (A:)
    masdykddddkrrrgmegaklsavriavreapyrqflgrrepsvvqfppwsdgkslivdq
    nefhfdhafpatisqdemyqalilplvdkllegfqctalaygqtgtgksysmgmtppgei
    lpehlgilpralgdifervtarqennkdaiqvyasfieiynekpfdllgstphmpmvaar
    cqrctclplhsqadlhhilelgtrnrrvrptnmnsnssrshaivtihvkskthhsrmniv
    dlagsegvrrtghegvarqegvninlgllsinkvvmsmaaghtvipyrdsvlttvlqasl
    taqsyltflacisphqcdlsetlstlrfgtsakaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dcbA (A:)
    klsavriavreapyrqflgrrepsvvqfppwsdgkslivdqnefhfdhafpatisqdemy
    qalilplvdkllegfqctalaygqtgtgksysmgmtppgeilpehlgilpralgdiferv
    tarqennkdaiqvyasfieiynekpfdllgstphmpmvaarcqrctclplhsqadlhhil
    elgtrnrrvssrshaivtihvkskthhsrmnivdlagsegvrrtvninlgllsinkvvms
    maaghtvipyrdsvlttvlqasltaqsyltflacisphqcdlsetlstlrfgtsakaaa