PDB entry 3dc9

View 3dc9 on RCSB PDB site
Description: Use of Carbonic Anhydrase II, IX Active-Site Mimic, for the Purpose of Screening Inhibitors for Possible Anti-Cancer Properties
Class: lyase
Keywords: Carbonic anhydrase II complex, CAIX mimic inhibitors, Acetylation, Cytoplasm, Disease mutation, Lyase, Metal-binding, Polymorphism, Zinc
Deposited on 2008-06-03, released 2009-03-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-07-07, with a file datestamp of 2009-07-02.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.16
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (Start-259)
      • engineered (64)
      • engineered (66)
    Domains in SCOPe 2.03: d3dc9a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dc9A (A:)
    mshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslril
    nnghsfqvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhl
    vhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdp
    rgllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelm
    vdnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dc9A (A:)
    hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
    hsfqvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
    ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
    lpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
    wrpaqplknrqikasfk