PDB entry 3dc6

View 3dc6 on RCSB PDB site
Description: Crystal Structure of a manganese superoxide dismutases from Caenorhabditis elegans
Class: oxidoreductase
Keywords: alpha hairpin N domain, alpha/beta C domain, OXIDOREDUCTASE, Manganese, Metal-binding, Mitochondrion, Transit peptide
Deposited on 2008-06-03, released 2009-06-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.171
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn] 1
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: sod-2, sdm-1, F10D11.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3dc6a1, d3dc6a2
  • Chain 'C':
    Compound: Superoxide dismutase [Mn] 1
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: sod-2, sdm-1, F10D11.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31161 (1-197)
      • initiating methionine (0)
    Domains in SCOPe 2.04: d3dc6c1, d3dc6c2
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dc6A (A:)
    mkhslpdlpydyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnvkeaia
    lqpalkfnggghinhsifwtnlakdggepsaelltaiksdfgsldnlqkqlsastvavqg
    sgwgwlgycpkgkilkvatcanqdpleattglvplfgidvwehayylqyknvrpdyvnai
    wkianwknvserfakaqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dc6A (A:)
    khslpdlpydyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnvkeaial
    qpalkfnggghinhsifwtnlakdggepsaelltaiksdfgsldnlqkqlsastvavqgs
    gwgwlgycpkgkilkvatcanqdpleattglvplfgidvwehayylqyknvrpdyvnaiw
    kianwknvserfakaqq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dc6C (C:)
    mkhslpdlpydyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnvkeaia
    lqpalkfnggghinhsifwtnlakdggepsaelltaiksdfgsldnlqkqlsastvavqg
    sgwgwlgycpkgkilkvatcanqdpleattglvplfgidvwehayylqyknvrpdyvnai
    wkianwknvserfakaqq