PDB entry 3dc5

View 3dc5 on RCSB PDB site
Description: Crystal Structure of a manganese superoxide dismutases from Caenorhabditis elegans
Class: oxidoreductase
Keywords: alpha hairpin N domain, alpha/beta C domain, OXIDOREDUCTASE, Manganese, Metal-binding, Mitochondrion, Transit peptide
Deposited on 2008-06-03, released 2009-06-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn] 2
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: sod-3, C08A9.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3dc5a1, d3dc5a2
  • Chain 'C':
    Compound: Superoxide dismutase [Mn] 2
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: sod-3, C08A9.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41977 (1-194)
      • initiating methionine (0)
    Domains in SCOPe 2.04: d3dc5c1, d3dc5c2
  • Heterogens: MN, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dc5A (A:)
    mkhtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaia
    lqpalkfnggghinhsifwtnlakdggepskelmdtikrdfgsldnlqkrlsditiavqg
    sgwgwlgyckkdkilkiatcanqdplegmvplfgidvwehayylqyknvrpdyvhaiwki
    anwkniserfanarq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dc5A (A:)
    khtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaial
    qpalkfnggghinhsifwtnlakdggepskelmdtikrdfgsldnlqkrlsditiavqgs
    gwgwlgyckkdkilkiatcanqdplegmvplfgidvwehayylqyknvrpdyvhaiwkia
    nwkniserfanarq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3dc5C (C:)
    mkhtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaia
    lqpalkfnggghinhsifwtnlakdggepskelmdtikrdfgsldnlqkrlsditiavqg
    sgwgwlgyckkdkilkiatcanqdplegmvplfgidvwehayylqyknvrpdyvhaiwki
    anwkniserfanarq