PDB entry 3dbz

View 3dbz on RCSB PDB site
Description: human surfactant protein D
Class: sugar binding protein
Keywords: SURFACTANT PROTEIN, CARBOHYDRATE RECOGNITION DOMAIN, Calcium, Coiled coil, Collagen, Extracellular matrix, Gaseous exchange, Glycoprotein, Hydroxylation, Lectin, Polymorphism, Secreted, Surface film, SUGAR BINDING PROTEIN
Deposited on 2008-06-02, released 2008-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pulmonary surfactant-associated protein D
    Species: Homo sapiens [TaxId:9606]
    Gene: SFTPD, PSPD, SFTP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dbza1, d3dbza2
  • Chain 'B':
    Compound: Pulmonary surfactant-associated protein D
    Species: Homo sapiens [TaxId:9606]
    Gene: SFTPD, PSPD, SFTP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35247 (7-159)
      • expression tag (5-6)
    Domains in SCOPe 2.07: d3dbzb1, d3dbzb2, d3dbzb3
  • Chain 'C':
    Compound: Pulmonary surfactant-associated protein D
    Species: Homo sapiens [TaxId:9606]
    Gene: SFTPD, PSPD, SFTP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3dbzc1, d3dbzc2
  • Heterogens: CA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3dbzA (A:)
    amadigsdvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpft
    eaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvys
    nwapgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dbzA (A:)
    vaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctq
    aggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepn
    ddggsedcveiftngkwndracgekrlvvcef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3dbzB (B:)
    amadigsdvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpft
    eaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvys
    nwapgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dbzB (B:)
    gsdvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqll
    ctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapg
    epnddggsedcveiftngkwndracgekrlvvcef
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3dbzC (C:)
    amadigsdvaslrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpft
    eaqllctqaggqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvys
    nwapgepnddggsedcveiftngkwndracgekrlvvcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3dbzC (C:)
    slrqqvealqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqag
    gqlasprsaaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepndd
    ggsedcveiftngkwndracgekrlvvcef